PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0034400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 270aa    MW: 29925.7 Da    PI: 6.3611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0034400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d+v  +G ++W+++a + g+ R +k+c++rw +yl
   Spipo1G0034400 15 KGLWSPEEDQKLRDYVLNYGHDCWSAVATKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding61.32.1e-1968113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE+e +++++++lG++ W+ Ia++++ gRt++++k++w++yl
   Spipo1G0034400  68 RGLFTPEEEETILCLHAMLGNK-WSQIASHLP-GRTDNEVKNHWNSYL 113
                      788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7571062IPR017930Myb domain
SuperFamilySSF466891.58E-2913109IPR009057Homeodomain-like
SMARTSM007174.0E-121464IPR001005SANT/Myb domain
PfamPF002496.1E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231669IPR009057Homeodomain-like
CDDcd001675.40E-111862No hitNo description
PROSITE profilePS5129428.54163117IPR017930Myb domain
SMARTSM007177.1E-1867115IPR001005SANT/Myb domain
PfamPF002494.7E-1868113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2770117IPR009057Homeodomain-like
CDDcd001679.91E-1471113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGCRACDQPK IKYRKGLWSP EEDQKLRDYV LNYGHDCWSA VATKAGLQRN GKSCRLRWIN  60
YLRPGLKRGL FTPEEEETIL CLHAMLGNKW SQIASHLPGR TDNEVKNHWN SYLKKKVRSA  120
AEKPSISPEE ANSRVSCLGS PEPTETSSAD SDDQRNAEQK PSAAAAPRNP LPRVLFAEWL  180
PEERADERNL ANPVFPASFR CHPAAATVDE VFRESGASLV PGLTMGGFFP QMGETNIFGD  240
LPPQFESEGQ ISGGGLFDFL PMPEFCSNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28151177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940754.12e-89PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-57LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D9W7I68e-80A0A0D9W7I6_9ORYZ; Uncharacterized protein
STRINGBRADI5G16672.16e-76(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.18e-59myb domain protein 18